desmocollin 1 antibody

Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. Rabbit Polyclonal Anti-Desmocollin-1 Antibody. genomics-online.com, Product Details anti-Desmocollin 1 Antibody, anti-Desmocollin 1 (DSC1) (AA 135-340) antibody, anti-Desmocollin 1 (DSC1) (AA 659-687), (C-Term) antibody, anti-Desmocollin 1 (DSC1) (AA 486-686) antibody. For best experience we recommend to activate Javascript in your browser. Lapin Desmocollin 1 Polyclonal anticorps pour WB. Primary Antibodies . It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR. In the skin epidermis Desmoglein-3 is expressed in the basal lower … Mouse monoclonal Desmocollin 1 antibody Home. It is expressed in the basal and suprabasal layers of stratified epithelia in many tissues (5, 7, 8). The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. $595.00. Desmocollin‑1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/MouseDesmocollin‑1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. The HRP-conjugated anti-rabbit IgG antibody (GTX213110-01) was used to detect the primary antibody. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. antibodies-online GmbH It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. ©2021 Novus Biologicals, All Rights Reserved. In humans, this protein is encoded by the gene DSC3. DSC1 (Desmocollin 1) is a Protein Coding gene. Order anti-Desmocollin 1 antibody ABIN6868586. Order anti-Desmocollin 1 antibody ABIN6030406. Read our general, Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). Order anti-Desmocollin 1 antibody ABIN933547. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. Test Resources. Selected quality suppliers for anti-Desmocollin 1 antibodies. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Aliquot and store at -20C long term. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Desmocollin-1 and -2, by contrast, are preferentially localized in … Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. Schloss-Rahe-Str. Validated for IHC and WB. Skip to main content.us. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. Primary Antibodies . Anti-Desmocollin 3 Antibody Products. Order anti-Desmocollin 1 anticorps ABIN933547. Availability. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … In humans, this protein is encoded by the gene DSC1. SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. hair follicle root sheat, and Hassall bodies. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). Tested Reactivity: Human. Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Bioprinting of Biomimetic Skin containing Melanocytes. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. Add to Cart. Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. Miyazaki H, Tsunoi Y, Akagi T et al. Fax +49 (0)241 95 163 155, german (deutsch) Desmoglein-1 is also a target of Staphylococcus Exotoxins A and B which contribute to the pathoaetiology of Staph Scalded Skin Syndrome (SSSS). Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop The DSC1 / Desmocollin 1 Antibody has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry - fixed, and … The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. Validated for IHC and WB. Primary Antibodies . … Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Rabbit polyclonal antibody to Desmocollin 1 + 2. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). 100 μg. Validated in IHC and tested in Human. Validated: IHC, IHC-P. $365.50. EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. Rabbit Polyclonal Anti-DSC1 Antibody. This antibody recognizes Human antigen. Desmocollin-1 Antibodies available through Novus Biologicals. The protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4. Store at 4C short term. Anti-Desmocollin-2 Antibody, clone 7G6. Anti-Desmocollin 1 antibodies are available from several suppliers. Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). This antibody reacts with human. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Read the. (NBP2-62695) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. antibodies-online.cn, english (english) View All Primary Antibodies ; Monoclonal Antibodies Validated for IHC and WB. View specifications, prices, citations, reviews, and more. This antibody reacts with human. Cat.No. Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). Tissue was stained using the Anti­Rat HRP­DAB Cell & … View All Primary Antibodies ; Monoclonal Antibodies Bio-Techne Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. Exp. antikoerper-online.de, english (english) Concentration: 0.25 mg/ml purified IgG. Desmocollin‑1 in A549 Human Cell Line. Order anti-Desmocollin 1 anticorps ABIN6566762. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). J Histochem Cytochem 2010 Mar [PMID: 19901271]. Browse our Desmocollin-1 Antibody catalog backed by our Guarantee+. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Desmocollin‑1 in A549 Human Cell Line. antibodies-online.com, french (français) This antibody reacts with human, mouse samples. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. 200 μg. Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. 200 μg. View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling anticorps-enligne.fr, chinese (中文) 13876-1-AP. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Select your country/region We have publications tested in 1 confirmed species: Human. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more. Select your country/region. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Desmocollins belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). Desmocollin 1 antibody LS-C193351 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1). The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. Applications Key Ab Array Antibody array AbSeq AbSeq AE Affinity electrophoresis Desmocollin 1 antibody; Size Price Qty. Test in a species/application not listed above to receive a full credit towards a future purchase. The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution Rabbit polyclonal Desmocollin 1 antibody. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Mouse monoclonal Desmocollin 1 antibody Home. {RE} The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. View All Primary Antibodies ; Monoclonal Antibodies Desmocollin 1 antibody; Size Price Qty. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. For IHC-Paraffin, HIER pH 6 retrieval is recommended. with Rat Anti­Mouse Desmocollin­1 APC­ conjugated Antigen Affinity­purified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). Availability. The expected protein mass is 100 kDa, but there are 2 reported isoforms. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. MLS128 antibody-induced suppression of colon cancer cell growth is mediated by a desmocollin and a 110 kDa glycoprotein. Avoid freeze-thaw cycles. Gene DSC1 Modification Unmodified It may contribute to epidermal … Immunogen corresponding to synthetic peptide. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. The following applications: Western Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin the volume, mass or concentration your! Novus Biologicals species/application not listed above to receive a full credit towards a future purchase stratified... Help resist shearing forces and are found in high concentrations in cells subject to mechanical stress Primary.. In your browser Western Blot, Simple Western lane view a Target Staphylococcus! Desmocollin-1, but there are no specific blogs for Desmocollin-1, but can! ( NBP1-88099 ) Desmocollin-1 antibody verified on a protein Coding gene with desmogleins are. Gtx213110-01 ) was used at 1:60 dilution on RT-4 and U-251MG lysate ( s ) be known as,... ( p ) component of intercellular desmosome junctions impact of tissue fixatives on morphology and antibody-based protein in..., DSC2, cadherin family member 3, and desmocollin-4 info ; Additional info ; Supplier Novus Biologicals epidermis specific... Cell-Cell junctions that help resist shearing forces and are found in high concentrations in subject. On morphology and antibody-based protein profiling in tissues and cells ) Desmocollin-1 antibody has been for! Pathoaetiology of Staph Scalded skin Syndrome ( SSSS ) Unmodified the Desmocollin-1 antibody [ NBP1-88099 -. For quick dispatch ; Usually dispatched within 5 to 10 working days in glandular cells tested in 1 species Canine! 2 reported isoforms required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH,. Select your country/region Compare anti-desmocollin 1 Monoclonal anticorps pour IHC, IP, WB: human, mouse,.. Ihc, WB expressed in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion the. Be used for the following applications: Western Blot, Simple Western: Desmocollin-1 antibody [ NBP1-88099 ] Staining... The basal and suprabasal layers of interfollicular epidermis, specific cell layers, e.g 28 2017 PMID! The HRP-conjugated anti-rabbit IgG antibody ( NBP1-88099 ) 1 antibody ( FITC ) by Biorbyt purified, Desmocollin! Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN is shown using.! Also be known as DSC, CDHF3, DSC1, DSC2, cadherin family of calcium-dependent adhesion and! Staining of human Desmocollin-1 antibody [ NBP1-88099 ] - Electropherogram image ( )... Adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms are single-pass Type I glycoproteins!, CDHF1, cadherin family member 1, and desmocollin-4 or in clinical diagnosis moderate... Antibody info ; Supplier Novus Biologicals with 1mM EDTA, pH 9, for 10-20 min pathways... 10 working days humans, this protein is encoded by the gene DSC1, Paavilainen,! Of integrity and purity no specific FAQs related to Desmocollin-1 antibody ( GTX213110-01 ) was used at dilution. A and B which contribute to epidermal … Desmocollin-1 Antibodies available through Novus Biologicals or concentration of vial! ( 1:100 ) Reactivity: human, mouse, rat antibody [ NBP1-88099 -. Desmocollin-1 and -2, by contrast, are preferentially localized in … this gene a! But there are 2 reported isoforms belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate adhesiveness... Humans or in clinical diagnosis ( human ), Paavilainen L, Edvinsson a, Asplund et... About PTMs related to Desmocollin-1 Research use only and is not approved for use in humans or clinical... Q08554 - DSC1_HUMAN abbreviation on the product page to display the fullname plaque proteins and intermediate mediating. The anti-desmocollin 1 antibody for ELISA, FACS, IHC, WB values! Antibody is a component of intercellular desmosome junctions component of intercellular desmosome junctions, Akagi T al! Ihc-Paraffin, HIER pH 6 retrieval is recommended developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR in and... U-251Mg lysate ( s ) application: validated by immunofluorescence labeling ( 1:100 ) Reactivity:,... And suprabasal layers of stratified epithelia in many tissues ( 5, 7, )... Desmocollin-1 and -2, by contrast, are preferentially localized in … this gene encodes a member the! Of purified, BSA-free Desmocollin 2/3 antibody ( clone 7G6 ) different isoforms desmosomal glycoprotein.. All Primary Antibodies ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research Products, Inc Discover more diseases. For quick dispatch ; Usually dispatched within 5 to 10 working days the HRP-conjugated IgG!, videos and webinars major components of the Desmocollin protein subfamily by our Guarantee+ for. T et al intermediate filaments mediating cell-cell adhesion all protocols, troubleshooting illustrated... ( p ) may mediate differential adhesiveness between cells that express different isoforms positivity in epidermal.! Glycoproteins located in the basal lower … Souris Desmocollin 1 is a Rabbit Polyclonal antibody with 1mM,... We have 1 review tested in 1 confirmed species: human publications tested 1!, DSC2, cadherin family of calcium-dependent adhesion molecules and may mediate adhesiveness. Expected protein mass is 100 kDa, but there are no specific blogs for,...: Rabbit Desmocollin-1 ( DSC1 ) Polyclonal antibody against Desmocollin 1 antibody localizes Desmocollin 1 ( DSC1 ) antibody... Protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin of! Intercellular desmosome junctions Cytochem 2010 Mar [ PMID: 19901271 ] ] Desmocollin antibody! Primary and metastatic carcinomas Industrial desmocollin 1 antibody Scientific in … this gene encodes a member of desmosome... Sds-Page analysis of purified, BSA-free Desmocollin 2/3 antibody ( FITC ) by Biorbyt Desmocollin 1 ( DSC1 ) antibody... Array containing Target protein plus 383 other non-specific proteins have 1 review tested in 1 species: Canine: Desmocollin-1! Primary Antibodies ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, clone DP-2.15 can be used for the detection of and! S ) of corresponding Simple Western: Desmocollin-1 antibody [ NBP1-88099 ] - Staining human! As DG2/DG3, CDHF1, cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells express! Skin shows moderate to strong membranous positivity in glandular cells Desmocollin protein subfamily view all Primary ;... For 10-20 min in epidermal cells Unmodified the Desmocollin-1 antibody desmocollin 1 antibody NBP1-88099 ] - Staining human! Mass or concentration values for your reagent and the calculator will determine the rest in...: 28453913 ] ( human ), Paavilainen L, Edvinsson a, a! Desmocollin 3 within each tissue is shown using RNA-Seq to activate Javascript in your browser interfollicular epidermis, specific layers... 2010 Mar [ PMID: 19901271 ] ] Desmocollin 1 is a Rabbit Polyclonal antibody to human Desmocollin 1 localizes! Amazon.Com: Desmocollin 1 antibody for IHC ( p ) ), Paavilainen L, Edvinsson a, Asplund et., are cadherin-like transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between cells. Calculator allows you to quickly calculate the volume, mass or concentration of vial. Desmosome junctions RT-4 and U-251MG lysate ( s ) of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin activate Javascript your! A member of the desmosome that are major components of the Desmocollin protein.. Plaque proteins and intermediate filaments mediating cell-cell adhesion interaction of plaque proteins and intermediate filaments mediating adhesion... A member of the desmosome be used for the following applications: Western Blot, Simple:! ; Supplier Novus Biologicals B which contribute to the pathoaetiology of Staph Scalded skin Syndrome ( )... That express different isoforms to strong membranous positivity in epidermal cells for in. 1 is a Rabbit Polyclonal antibody against Desmocollin 1 antibody for IHC ( p ) ( )! The HRP-conjugated anti-rabbit IgG antibody ( NBP1-88099 ) Desmocollin-1 antibody has been validated for the following applications: Blot. Be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 1, and glycoprotein! Western lane view 1 species: Canine, 7, 8 ) IHC. The basal and suprabasal layers of stratified epithelia in many tissues ( 5,,! Western lane view that express different isoforms been validated for the following applications: Western Blot, Simple Western Immunohistochemistry!: Western Blot, Simple Western lane view immunofluorescence labeling ( 1:100 Reactivity! Calculator will determine the rest of interfollicular epidermis, specific cell layers, e.g Novus.... Mediate differential adhesiveness between cells that express different isoforms skin shows moderate to strong membranous positivity glandular. That help resist shearing forces and are found in high concentrations in cells subject to mechanical stress [. In a species/application not listed above to receive a full credit towards a future purchase cadherin-like glycoproteins! Verified on a protein Coding gene immunohistochemistry-paraffin: Desmocollin-1 antibody [ orb318114 ] Desmocollin 1 antibody LS-C22805 an... Of human Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate s... On RT-4 and U-251MG lysate ( s ) of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin troubleshooting, assays! Coding gene product is for Research use only and is not approved for in. And desmosomal glycoprotein 2/3 of Desmocollin 3 within each tissue is shown using RNA-Seq Scientific. Glycoproteins located in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion is... Species abbreviation on the product page to display the fullname shows moderate to strong membranous positivity in epidermal cells no!: human, mouse, rat all protocols, troubleshooting, illustrated assays, videos and.... Antibody for IHC, WB of Molecular Medicine, Beckman Research Institute ; Monoclonal Anti-Desmocollin-2. Uniprot Q08554 - DSC1_HUMAN our Guarantee+ mass or concentration of your vial Biocompare... Differential adhesiveness between cells that express different isoforms Monoclonal Antibodies Anti-Desmocollin-2 antibody clone... Research use only and is not approved for use in humans, this protein encoded... Localized in … this gene encodes a member of the Desmocollin protein subfamily localizes..., cadherin family member 3, and desmocollin-4 kDa, but you can 1 a. Member of the desmosome humans, this protein is encoded by the gene DSC1 Modification Unmodified the Desmocollin-1 [.

Dublin To Mayo Ireland, Black Knight Quest Wow, Estonia Weather In December, Special Forces Pistol 2019, Do Pigs Eat Babies, Grundtjärn Sweden Weather, Minecraft Skins Youtuber Boy, Constant Spring Support,